Structure of PDB 7at8 Chain A

Receptor sequence

>7at8A (length=311) Species: 9606 (Homo sapiens)

WSPLQQNFMVEGTFIEELIKNYDLFCRRCFKYDCFLHPEASMFRVLIGTY
YDNFCAIARLIRQVYEFRVKESAAAAAAAAAAAAANHVYNYQPCDHPRQP
CDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRE
CDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIK
DPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATR
KGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYS
QADALKYVGIE

3D structure

• PDB: 7at8 Structural basis for PRC2 decoding of active histone methylation marks H3K36me2/3.
• Chain: A
• Resolution: 4.4 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.356: [histone H3]-lysine(27) N-trimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C286 C289 C294 H297	C26 C29 C34 H37
BS02	ZN	A	C548 C561 C567 C571	C101 C114 C120 C124
BS03	ZN	A	C541 H543 C548 C552	C94 H96 C101 C105
BS04	ZN	A	C541 C554 C561 C565	C94 C107 C114 C118
BS05	ZN	A	C598 C606 C619	C151 C159 C172
BS06	ZN	A	C578 C591 C598 C603	C131 C144 C151 C156
BS07	ZN	A	C578 C580 C584 C589	C131 C133 C137 C142
BS08	SAH	A	A640 G641 W642 M680 C681 S682 F683 N706 L752	A193 G194 W195 M233 C234 S235 F236 N259 L305	BindingDB: IC50=467nM

Gene Ontology

Molecular Function

• GO:0042054 histone methyltransferase activity
• GO:0046976 histone H3K27 methyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling

External links

• PDB: RCSB:7at8, PDBe:7at8, PDBj:7at8
• PDBsum: 7at8
• PubMed: 33211010
• UniProt: Q15910|EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 (Gene Name=EZH2)