Structure of PDB 7aqg Chain A

Receptor sequence

>7aqgA (length=362) Species: 9606 (Homo sapiens) [Search protein sequence]

PPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGE
TQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDL
KLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLG
KGAVDQLTRLVLVNALYFNGQFKTPFPDSSTHRRLFHKSDGSTVSVPMMA
QTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNI
LSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQ
ADFTSLSDQEPLHVAQALQKVKIEVNESGTVPEEIIMDRPFLFVVRHNPT
GTVLFMGQVMEP

3D structure

PDB

7aqg Structural Insight into the Two-Step Mechanism of PAI-1 Inhibition by Small Molecule TM5484.

Chain

Resolution

2.27 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RV2	A	F114 T120 K122 Q123	F111 T117 K119 Q120	BindingDB: IC50=3560nM

Gene Ontology

	Molecular Function
GO:0002020	protease binding
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005102	signaling receptor binding
GO:0005515	protein binding

	Biological Process
GO:0001525	angiogenesis
GO:0010466	negative regulation of peptidase activity
GO:0010469	regulation of signaling receptor activity
GO:0010757	negative regulation of plasminogen activation
GO:0010951	negative regulation of endopeptidase activity
GO:0014912	negative regulation of smooth muscle cell migration
GO:0030194	positive regulation of blood coagulation
GO:0030195	negative regulation of blood coagulation
GO:0030336	negative regulation of cell migration
GO:0032757	positive regulation of interleukin-8 production
GO:0033629	negative regulation of cell adhesion mediated by integrin
GO:0035491	positive regulation of leukotriene production involved in inflammatory response
GO:0042730	fibrinolysis
GO:0045766	positive regulation of angiogenesis
GO:0048260	positive regulation of receptor-mediated endocytosis
GO:0050729	positive regulation of inflammatory response
GO:0050829	defense response to Gram-negative bacterium
GO:0051918	negative regulation of fibrinolysis
GO:0061044	negative regulation of vascular wound healing
GO:0061045	negative regulation of wound healing
GO:0071222	cellular response to lipopolysaccharide
GO:0090026	positive regulation of monocyte chemotaxis
GO:0090399	replicative senescence
GO:0097187	dentinogenesis
GO:1901331	positive regulation of odontoblast differentiation
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2000098	negative regulation of smooth muscle cell-matrix adhesion
GO:2000352	negative regulation of endothelial cell apoptotic process

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005886	plasma membrane
GO:0031093	platelet alpha granule lumen
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0097180	serine protease inhibitor complex
GO:1904090	peptidase inhibitor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7aqg, PDBe:7aqg, PDBj:7aqg
PDBsum	7aqg
PubMed	33540702
UniProt	P05121\|PAI1_HUMAN Plasminogen activator inhibitor 1 (Gene Name=SERPINE1)

[Back to BioLiP]