Structure of PDB 7ao9 Chain A

Receptor sequence

>7ao9A (length=168) Species: 9606 (Homo sapiens) [Search protein sequence]

GEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFL
VVARSVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISAL
VPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTS
IIEYYYMWKTTDRYVQQK

3D structure

PDB

7ao9 The topology of chromatin-binding domains in the NuRD deacetylase complex.

Chain

Resolution

6.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IHP	A	K305 Y327 K331	K133 Y155 K159

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0003714	transcription corepressor activity
GO:0005515	protein binding
GO:0042826	histone deacetylase binding
GO:0043565	sequence-specific DNA binding
GO:0046872	metal ion binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006302	double-strand break repair
GO:0006338	chromatin remodeling
GO:0006355	regulation of DNA-templated transcription
GO:0007165	signal transduction
GO:0010212	response to ionizing radiation
GO:0032922	circadian regulation of gene expression
GO:0042659	regulation of cell fate specification
GO:0043153	entrainment of circadian clock by photoperiod
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045475	locomotor rhythm
GO:0045814	negative regulation of gene expression, epigenetic
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:0048511	rhythmic process
GO:1902499	positive regulation of protein autoubiquitination
GO:2000736	regulation of stem cell differentiation

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0016581	NuRD complex
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ao9, PDBe:7ao9, PDBj:7ao9
PDBsum	7ao9
PubMed	33264408
UniProt	Q13330\|MTA1_HUMAN Metastasis-associated protein MTA1 (Gene Name=MTA1)

[Back to BioLiP]