Structure of PDB 7al4 Chain A

Receptor sequence

>7al4A (length=517) Species: 9685 (Felis catus)

AKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGR
ASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANRFNLL
KHIQFKTKVCSVTKCPDFTVTGQWEVVTQHEGKQESAIFDAVMVCTGFLT
DPYLPLDSFPGINTFKGQYFHSRQYKHPDIFKDKRVLVVGMGNSGTDIAV
EASHLAKKVFLSTTGGAWVMSRVFDSGYPWDMVFTTRFQNMLRNSLPTPI
VTWLMARKMNSWFNHANYGLVPEDRTQLREPVLNDELPGCIITGKVLIKP
SIKEVKENSVIFNNTPKEEPIDIIVFATGYTFAFPFLDESVVKVENGQAS
LYKYIFPAHLPKPTLAVIGLIKPLGSIIPTGETQARWAVRVLKGINKLPP
QSVMIEEVNARKENKPSGFGLCYCKALQSDYITYIDELLTYINAKPNLLS
MLLTDPRLALTIFFGPCTPYQFRLTGPGKWEGARNAILTQWDRTFKVTKT
RIVQESPSPFASLLKLL

3D structure

• PDB: 7al4 Ancestral reconstruction of mammalian FMO1 enables structural determination, revealing unique features that explain its catalytic properties.
• Chain: A
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G9 G11 V12 S13 F31 E32 R33 G39 L40 W41 V58 S60 N61 S62 V110 T147 F337 S377 I378	G8 G10 V11 S12 F30 E31 R32 G38 L39 W40 V57 S59 N60 S61 V109 T146 F336 S376 I377
BS02	NAP	A	Y55 V59 N61 F160 G193 N194 S195 T214 T215 R280 E281 A328 T329 G330	Y54 V58 N60 F159 G192 N193 S194 T213 T214 R279 E280 A327 T328 G329

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 23:04:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7al4', asym_id = 'A', title = 'Ancestral reconstruction of mammalian FMO1 enabl... features that explain its catalytic properties. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7al4', asym_id='A', title='Ancestral reconstruction of mammalian FMO1 enabl... features that explain its catalytic properties. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004499,0050660,0050661', uniprot = '', pdbid = '7al4', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004499,0050660,0050661', uniprot='', pdbid='7al4', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>