Structure of PDB 7ah0 Chain A

Receptor sequence
>7ah0A (length=104) Species: 32630 (synthetic construct) [Search protein sequence]
SPELREKHRALAEQVYATGQEMLKNTSNSPELREKHRALAEQVYATGQEM
LKSPELREKHRALAEQVYATGQEMLKNTSNSPELREKHRALAEQVYATGQ
EMLK
3D structure
PDB7ah0 An expandable, modular de novo protein platform for precision redox engineering.
ChainA
Resolution1.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A R6 H9 R10 V44 G48 M51 L52 H67 R68 A71 V102 Y103 G106 M109 L110 R5 H8 R9 V43 G47 M50 L51 H60 R61 A64 V95 Y96 G99 M102 L103
BS02 HEM A V16 G20 Q21 M23 R34 H37 A41 V74 G78 M81 L82 H95 R96 A99 V15 G19 Q20 M22 R33 H36 A40 V67 G71 M74 L75 H88 R89 A92
External links