Structure of PDB 7ae9 Chain A |
>7ae9A (length=141) Species: 1532906 (Aphanizomenon flos-aquae 2012/KM1/D3) [Search protein sequence] |
NIEPVIIETRLELIGRYLDHLKKFENISLDDYLSSFEQQLITEELLQLIT QAAIDINDHILSKLKSGKSYTNFEAFIELGKYQILTPELAKQIAPSSGLR EYDDIDPNQVFMAISFALQQYPLYVRQINSYLITLEEENDL |
|
PDB | 7ae9 HEPN-MNT Toxin-Antitoxin System: The HEPN Ribonuclease Is Neutralized by OligoAMPylation. |
Chain | A |
Resolution | 2.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2DA |
A |
I8 T11 R12 |
I6 T9 R10 |
|
|
|
|