Structure of PDB 7aa7 Chain A

Receptor sequence

>7aa7A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence]

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE
EDYFLYVAYSDESVY

3D structure

PDB

7aa7 Phosphorylation of the LIR Domain of SCOC Modulates ATG8 Binding Affinity and Specificity.

Chain

Resolution

1.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y5 H9 I21 R28 K46 K48 Y49 L50 P52 L63	Y5 H9 I21 R28 K46 K48 Y49 L50 P52 L63
BS02	SAT	A	Y61 F77 I84	Y61 F77 I84

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0008429	phosphatidylethanolamine binding
GO:0030957	Tat protein binding
GO:0031625	ubiquitin protein ligase binding
GO:0048487	beta-tubulin binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0000422	autophagy of mitochondrion
GO:0006914	autophagy
GO:0006995	cellular response to nitrogen starvation
GO:0061723	glycophagy
GO:0097352	autophagosome maturation

	Cellular Component
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005776	autophagosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0016020	membrane
GO:0030659	cytoplasmic vesicle membrane
GO:0031410	cytoplasmic vesicle

External links

PDB	RCSB:7aa7, PDBe:7aa7, PDBj:7aa7
PDBsum	7aa7
PubMed	33845085
UniProt	Q9H0R8\|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)