Structure of PDB 7a1o Chain A

Receptor sequence

>7a1oA (length=347) Species: 9606 (Homo sapiens) [Search protein sequence]

ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRA
EELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLY
YDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLND
TVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDE
QQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERF
PNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPT
PKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

3D structure

PDB

7a1o 2-Oxoglutarate derivatives can selectively enhance or inhibit the activity of human oxygenases.

Chain

Resolution

2.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.11.30: hypoxia-inducible factor-asparagine dioxygenase.
1.14.11.n4: ankyrin-repeat-histidine dioxagenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	Y102 D104 E105 K106 H199 D201 E202 Q203 R238 Q239 W296 K304 I306 A317 I318 N321	Y100 D102 E103 K104 H197 D199 E200 Q201 R236 Q237 W294 K302 I304 A315 I316 N319
BS02	ZN	A	H199 D201 H279	H197 D199 H277
BS03	QVT	A	Y145 L188 T196 H199 N205 F207 K214 H279 I281 W296	Y143 L186 T194 H197 N203 F205 K212 H277 I279 W294

Gene Ontology

	Molecular Function
GO:0003714	transcription corepressor activity
GO:0005112	Notch binding
GO:0005515	protein binding
GO:0008198	ferrous iron binding
GO:0008270	zinc ion binding
GO:0019826	oxygen sensor activity
GO:0031406	carboxylic acid binding
GO:0036139	peptidyl-histidine dioxygenase activity
GO:0036140	[protein]-asparagine 3-dioxygenase activity
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0051059	NF-kappaB binding
GO:0051213	dioxygenase activity
GO:0062101	peptidyl-aspartic acid 3-dioxygenase activity
GO:0071532	ankyrin repeat binding

	Biological Process
GO:0045663	positive regulation of myoblast differentiation
GO:0045746	negative regulation of Notch signaling pathway
GO:0045892	negative regulation of DNA-templated transcription
GO:2001214	positive regulation of vasculogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7a1o, PDBe:7a1o, PDBj:7a1o
PDBsum	7a1o
PubMed	34759269
UniProt	Q9NWT6\|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor (Gene Name=HIF1AN)

[Back to BioLiP]