Structure of PDB 6zxe Chain A

Receptor sequence
>6zxeA (length=216) Species: 9606 (Homo sapiens) [Search protein sequence]
SGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINL
KRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAG
RFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTD
SPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL
YFYRDPEEIEKEEQAA
3D structure
PDB6zxe Structural basis for the final steps of human 40S ribosome maturation.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A F32 R102 P105 T109 N110 Q111 I112 Q132 E136 Y139 R155 F31 R101 P104 T108 N109 Q110 I111 Q131 E135 Y138 R154
Gene Ontology
Molecular Function
GO:0001618 virus receptor activity
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005055 laminin receptor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
GO:0043236 laminin binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0007155 cell adhesion
GO:0046718 symbiont entry into host cell
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zxe, PDBe:6zxe, PDBj:6zxe
PDBsum6zxe
PubMed33208940
UniProtP08865|RSSA_HUMAN Small ribosomal subunit protein uS2 (Gene Name=RPSA)

[Back to BioLiP]