Structure of PDB 6zuq Chain A |
>6zuqA (length=143) Species: 5499 (Fulvia fulva) [Search protein sequence] |
GHMLDCKAVALKWVHQFRIPGGDNCNFYCSYDSLYQQFNLWKKNDACQGA DGFSTAIPKIQEAPCSDCPGSKTCICSVQATAWRVRNGKWFDGQQWFDCD VKPYTERVLGRRWYDESEADKDIYVGYYSRGFISNDNVHCGSQ |
|
PDB | 6zuq A new family of structurally conserved fungal effectors displays epistatic interactions with plant resistance proteins. |
Chain | A |
Resolution | 1.94 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H-1 H136 Q140 |
H2 H139 Q143 |
|
|
|
|