Structure of PDB 6zot Chain A |
>6zotA (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] |
NYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAY RSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAKGKFEVKWIFVKDVP NNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDD |
|
PDB | 6zot Structural and Dynamic Insights into Redundant Function of YTHDF Proteins. |
Chain | A |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
R520 N526 |
R108 N114 |
|
|
|
|