Structure of PDB 6zmn Chain A |
>6zmnA (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] |
PAVKRLLGWKQGDEEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNT KCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFA FNMKKDEVCVNPYHYQRVET |
|
PDB | 6zmn Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes. |
Chain | A |
Resolution | 2.333 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C61 C106 C118 H123 |
C52 C97 C109 H114 |
|
|
|
|