Structure of PDB 6zjd Chain A

Receptor sequence
>6zjdA (length=214) Species: 9606 (Homo sapiens) [Search protein sequence]
RLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVL
AKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRA
YQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTG
EPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIW
PYVYAFLQTKVPQR
3D structure
PDB6zjd Structural Basis for GTP versus ATP Selectivity in the NMP Kinase AK3.
ChainA
Resolution1.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K20 R94 R128 R161 R172
Catalytic site (residue number reindexed from 1) K15 R89 R123 R156 R167
Enzyme Commision number 2.7.4.10: nucleoside-triphosphate--adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP A S38 G39 L42 R43 L65 I66 M71 R94 Q98 R172 S33 G34 L37 R38 L60 I61 M66 R89 Q93 R167 MOAD: Kd=13uM
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0016874 ligase activity
GO:0019205 nucleobase-containing compound kinase activity
GO:0046899 nucleoside triphosphate adenylate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006172 ADP biosynthetic process
GO:0007596 blood coagulation
GO:0009117 nucleotide metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009142 nucleoside triphosphate biosynthetic process
GO:0016310 phosphorylation
GO:0046033 AMP metabolic process
GO:0046039 GTP metabolic process
GO:0046041 ITP metabolic process
GO:0046051 UTP metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zjd, PDBe:6zjd, PDBj:6zjd
PDBsum6zjd
PubMed32822537
UniProtQ9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial (Gene Name=AK3)

[Back to BioLiP]