Structure of PDB 6z7o Chain A |
>6z7oA (length=110) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAHEYS DRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAK LMEKHACIVD |
|
PDB | 6z7o Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins. |
Chain | A |
Resolution | 2.33 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E88 H105 |
E88 H105 |
|
|
|
|