Structure of PDB 6z15 Chain A |
>6z15A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] |
NVAHGLAWSYYIGYLRLILPELQARIRTYNQHRGAVSQRLYILLPLDCGV PDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCV LEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNN CRLIAYQEPSSFSLSQEVLRHLRQEEKEE |
|
PDB | 6z15 Ligand Strain and Its Conformational Complexity Is a Major Factor in the Binding of Cyclic Dinucleotides to STING Protein. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2BA |
A |
S162 Y167 R238 Y240 |
S9 Y14 R80 Y82 |
BindingDB: EC50=200nM |
|
|
|