Structure of PDB 6yym Chain A

Receptor sequence

>6yymA (length=148) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]

DRNSVDYAQIASGIDTRTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLY
LRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICDISYA
NIQGKDRLIEKFRNSCVMDENPAYRPKIFVSHGPNRGMEEPFPAPNNA

3D structure

PDB

6yym A scaffold lncRNA shapes the mitosis to meiosis switch.

Chain

Resolution

2.63 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N582 M600 N603 N606 K607 Y629 R631 I632 D633 F634 V635 C638 V640 G641 Y642 F644 F668 H669 S670 K672 S677 Y678 A679 N680 I681 K690 F691 C695	N3 M21 N24 N27 K28 Y50 R52 I53 D54 F55 V56 C59 V61 G62 Y63 F65 F89 H90 S91 K93 S98 Y99 A100 N101 I102 K111 F112 C116

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:6yym, PDBe:6yym, PDBj:6yym
PDBsum	6yym
PubMed	33536434
UniProt	P08965\|MEI2_SCHPO Meiosis protein mei2 (Gene Name=mei2)

[Back to BioLiP]