Structure of PDB 6yur Chain A

Receptor sequence

>6yurA (length=255) Species: 1280 (Staphylococcus aureus)

VNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKL
LEQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMED
LRGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGE
FAVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGV
GGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSG
FHAIK

3D structure

• PDB: 6yur A Long Residence Time Enoyl-Reductase Inhibitor Explores an Extended Binding Region with Isoenzyme-Dependent Tautomer Adaptation and Differential Substrate-Binding Loop Closure.
• Chain: A
• Resolution: 1.96 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y157 K164
• Catalytic site (residue number reindexed from 1): Y156 K163
• Enzyme Commision number: 1.3.1.39: enoyl-[acyl-carrier-protein] reductase (NADPH, Re-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G13 A15 S19 I20 R40 K41 S44 D66 V67 S93 I94 A95 I120 T145 T146 K164 A190 P192 I193 T195 S197	G12 A14 S18 I19 R39 K40 S43 D65 V66 S92 I93 A94 I119 T144 T145 K163 A189 P191 I192 T194 S196
BS02	F9T	A	F96 A97 M99 Y147 Y157 M160 S197 V201	F95 A96 M98 Y146 Y156 M159 S196 V200

Gene Ontology

Molecular Function

• GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0050661 NADP binding
• GO:0141148 enoyl-[acyl-carrier-protein] reductase (NADPH) activity

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0030497 fatty acid elongation

External links

• PDB: RCSB:6yur, PDBe:6yur, PDBj:6yur
• PDBsum: 6yur
• PubMed: 33710875
• UniProt: Q2FZQ3|FABI_STAA8 Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI (Gene Name=fabI)