Structure of PDB 6ye6 Chain A

Receptor sequence

>6ye6A (length=341) Species: 83333 (Escherichia coli K-12)

QKTLHIYNWSDYIAPDTVANFEKETGIKVVYDVFDSNEVLEGKLMAGSTG
FDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLVAKHDPDNK
FAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVS
FLDAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQ
YINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFD
VFAMPADAKNKDEAYQFLNYLLRPDVVAHISDHVFYANANKAATPLVSAE
VRENPGIYPPADVRAKLFTLKVQDPKIDRVRTRAWTKVKSG

3D structure

• PDB: 6ye6 A comprehensive binding study illustrates ligand recognition in the periplasmic binding protein PotF.
• Chain: A
• Resolution: 1.56 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ONT	A	L119 W135	L91 W107
BS02	AG2	A	W37 S38 Y40 E185 W244 D247 F276 D278 Y314	W9 S10 Y12 E157 W216 D219 F248 D250 Y286
BS03	JFN	A	D113 W135 N316 K319 Y336	D85 W107 N288 K291 Y308
BS04	JFN	A	K202 A203 D204 K354	K174 A175 D176 K326
BS05	JFN	A	T53 Q294 R301	T25 Q266 R273
BS06	JFN	A	F266 S267 I268	F238 S239 I240
BS07	ONW	A	E50 K56	E22 K28

Gene Ontology

Molecular Function

• GO:0019808 polyamine binding
• GO:0019810 putrescine binding

Biological Process

• GO:0015846 polyamine transport
• GO:0015847 putrescine transport

Cellular Component

• GO:0016020 membrane
• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space
• GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing

External links

• PDB: RCSB:6ye6, PDBe:6ye6, PDBj:6ye6
• PDBsum: 6ye6
• PubMed: 33406388
• UniProt: P31133|POTF_ECOLI Putrescine-binding periplasmic protein PotF (Gene Name=potF)