Structure of PDB 6ya5 Chain A

Receptor sequence

>6ya5A (length=179) Species: 641809 (Influenza A virus (A/California/07/2009(H1N1)))

GSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMY
SDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRF
IEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEES
RARIKTRLFTIRQEMASRSLWDSFRQSER

3D structure

• PDB: 6ya5 Unraveling the anti-influenza effect of flavonoids: Experimental validation of luteolin and its congeners as potent influenza endonuclease inhibitors.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H43 D91 E102 I103
BS02	MG	A	E80 D108	E63 D91
BS03	LU2	A	A20 M21 Y24 E26 I38 H41 E80 D108 E119 K134	A22 M23 Y26 E28 I40 H43 E63 D91 E102 K117	MOAD: ic50=0.072uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:6ya5, PDBe:6ya5, PDBj:6ya5
• PDBsum: 6ya5
• PubMed: 32883638
• UniProt: C3W5X6