Structure of PDB 6y4j Chain A

Receptor sequence

>6y4jA (length=426) Species: 562 (Escherichia coli)

MAPSRANTKVIVVGGGGTIGSSTALHLVRSGYTPSNVTVLDAYPIPSSQS
AGNDLNKIMDADADPAADAARQMWNEDELFKKFFHNTGRLDCAHGEKDIA
DLKKRYQNLVDWGLDATVEWLDSEDEILKRMPQLTRDQIKGWKAIFSKDG
GWLAAAKAIKAIGEYLRDQGVRFGFYGAGSFKQPLLAEGVCIGVETVDGT
RYYADKVVLAAGAWSPTLVELQEQCVSKAWVYGHIQLTPEEAARYKNSPV
VYNGDVGFFFEPNEHGIIKVCDEFPGFTRFKMHQPFGAKAPKRISVPRSH
AKHPTDTIPDASIVRIRRAIATFMPQFKNKPLFNQAMCWCTDTADGHLLI
CEHPEWKNFYLATGDSGDSFKLLPIIGKYVVELLEGTLADELAHKWRWRP
GSGDALKSRREAPAKDLADMPGWNHD

3D structure

• PDB: 6y4j Rational backbone redesign of a fructosyl peptide oxidase to widen its active site access tunnel.
• Chain: A
• Resolution: 1.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G14 G17 T18 I19 D41 A42 S47 Q49 S50 A51 K57 I58 G179 S180 F181 A211 G212 W214 L218 C338 C340 D365 G367 D368 S369 F370 K371	G14 G17 T18 I19 D41 A42 S47 Q49 S50 A51 K57 I58 G179 S180 F181 A211 G212 W214 L218 C338 C340 D365 G367 D368 S369 F370 K371

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Mar 11 13:03:22 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6y4j', asym_id = 'A', title = 'Rational backbone redesign of a fructosyl peptide oxidase to widen its active site access tunnel.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6y4j', asym_id='A', title='Rational backbone redesign of a fructosyl peptide oxidase to widen its active site access tunnel.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491,0050660', uniprot = '', pdbid = '6y4j', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491,0050660', uniprot='', pdbid='6y4j', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>