Structure of PDB 6y2c Chain A |
>6y2cA (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] |
GIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQIT GPPDRCQHAAEIITDLLRSVQA |
|
PDB | 6y2c Comparative structural analyses and nucleotide-binding characterization of the four KH domains of FUBP1. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E337 D341 |
E61 D65 |
|
|
|
|