Structure of PDB 6xxj Chain A

Receptor sequence

>6xxjA (length=356) Species: 9606 (Homo sapiens)

EAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQAT
NFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNL
ISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKE
LRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMI
ARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVL
DIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGADYAVYIN
TAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQ
KMDAFM

3D structure

• PDB: 6xxj Half Way to Hypusine-Structural Basis for Substrate Recognition by Human Deoxyhypusine Synthase.
• Chain: A
• Resolution: 1.41 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.46: deoxyhypusine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SPD	A	H288 N292 D316 E323 W327 K329	H281 N285 D309 E316 W320 K322
BS02	NAD	A	T104 S105 N106 T131 A132 G133 E137 D238 G282 G283 N307 T308 A309 D342 A343	T97 S98 N99 T124 A125 G126 E130 D231 G275 G276 N300 T301 A302 D335 A336
BS03	SPD	A	S240 D243	S233 D236
BS04	NAD	A	G284 H288 D313 S315 D316 S317	G277 H281 D306 S308 D309 S310

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0034038 deoxyhypusine synthase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006412 translation
• GO:0008216 spermidine metabolic process
• GO:0008284 positive regulation of cell population proliferation
• GO:0008612 peptidyl-lysine modification to peptidyl-hypusine
• GO:0042102 positive regulation of T cell proliferation
• GO:0042593 glucose homeostasis
• GO:0046203 spermidine catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6xxj, PDBe:6xxj, PDBj:6xxj
• PDBsum: 6xxj
• PubMed: 32235505
• UniProt: P49366|DHYS_HUMAN Deoxyhypusine synthase (Gene Name=DHPS)