Structure of PDB 6xsa Chain A

Receptor sequence
>6xsaA (length=183) Species: 9606 (Homo sapiens) [Search protein sequence]
RMLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL
KTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASL
ALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPS
FVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP
3D structure
PDB6xsa De novo macrocyclic peptides for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex.
ChainA
Resolution1.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A L152 Y163 Y165 Q166 K173 V174 E175 R176 L153 Y164 Y166 Q167 K174 V175 E176 R177
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006886 intracellular protein transport
GO:0010506 regulation of autophagy
GO:0015031 protein transport
GO:0032456 endocytic recycling
GO:0042147 retrograde transport, endosome to Golgi
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030904 retromer complex
GO:0030906 retromer, cargo-selective complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xsa, PDBe:6xsa, PDBj:6xsa
PDBsum6xsa
PubMed34851660
UniProtQ9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 (Gene Name=VPS29)

[Back to BioLiP]