Structure of PDB 6xbq Chain A

Receptor sequence

>6xbqA (length=144) Species: 100226 (Streptomyces coelicolor A3(2))

SLTRIDHIGIACHDLDATVEFYRATYGFEVFHTEVNEEQGVREAMLKIND
TSDGGASYLQLLEPTREDSAVGKWLAKNGEGVHHIAFGTADVDADAADIR
DKGVRVLYDEPRRGSMGSRITFLHPKDCHGVLTELVTSAAVESP

3D structure

• PDB: 6xbq Streptomyces coelicolor methylmalonyl-CoA epimerase in complex with carboxy-carba(dethia)-CoA
• Chain: A
• Resolution: 1.64 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H7 E43 Q60 H84 E134
• Catalytic site (residue number reindexed from 1): H7 E43 Q60 H84 E134

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	A	H7 Q60 H84 E134	H7 Q60 H84 E134
BS02	CMX	A	Q39 Q60 A70 K73 W74 H83 H84 L107 F122 P125 K126 L132	Q39 Q60 A70 K73 W74 H83 H84 L107 F122 P125 K126 L132

Gene Ontology

Molecular Function

• GO:0004493 methylmalonyl-CoA epimerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0046491 L-methylmalonyl-CoA metabolic process

External links

• PDB: RCSB:6xbq, PDBe:6xbq, PDBj:6xbq
• PDBsum: 6xbq
• UniProt: Q9L2C2