Structure of PDB 6xam Chain A

Receptor sequence

>6xamA (length=395) Species: 1463854 (Streptomyces sp. NRRL F-5053)

TATLTYPFHDWSQELSPRYAQLRASDAPVCPVVSEGTGDPLWLVTRYATA
VKLLEDSRFSSEAAQASGAPRQEPVELRAPGTRGDAIAMLREAGLRSVLA
DGLGPRAVRRHQGWINDLAETLMSELASREGTFDLAADFVEPLSSALVSR
TLLGELSADERDLLAHCADTGLRFCGVTHEEQVHAFTQMHEFFLEHARRL
AGTPGEHLLKLIAEAPGPLSDEALAEAGSLLVVAGFPTSSGFLCGALLTL
LRHPDAVQELHAHPERVPSAVEELLRYTPLSTGSVKRMATEDLEIDGVRI
KAGEVVMVSLEAVNHDPDAFEDPDVFRPGREGPMHFGFGRGRHFCPGNRL
ARCVIEATVRAVARRPGLRLAVAPEEISWHEGLFFRRPRAIPATW

3D structure

• PDB: 6xam Structure and Function of NzeB, a Versatile C-C and C-N Bond-Forming Diketopiperazine Dimerase.
• Chain: A
• Resolution: 1.481 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	I90 A240 G241 F248 V291 R293 G343 F344 H349 C351 P352	I87 A234 G235 F242 V285 R287 G337 F338 H343 C345 P346
BS02	WMA	A	Q75 T244 S287 V291 K292 L316 F390 F391	Q72 T238 S281 V285 K286 L310 F384 F385
BS03	WMA	A	Q68 L236 V239 K292 F391	Q65 L230 V233 K286 F385

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Feb 18 11:01:27 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xam', asym_id = 'A', title = 'Structure and Function of NzeB, a Versatile C-C and C-N Bond-Forming Diketopiperazine Dimerase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xam', asym_id='A', title='Structure and Function of NzeB, a Versatile C-C and C-N Bond-Forming Diketopiperazine Dimerase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004497,0005506,0016705,0020037', uniprot = '', pdbid = '6xam', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004497,0005506,0016705,0020037', uniprot='', pdbid='6xam', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>