Structure of PDB 6xa2 Chain A

Receptor sequence

>6xa2A (length=399) Species: 529089 (Streptomyces sp. 307-9)

PLELDDAFMQDPHSVYARLNAEGSAHRVMMPPGVPVCGGLPVWLITGYEE
VRSALADPRLSTDLNRTDRLFAQNEPDRNKRGAFSSALATHMLHSDPPDH
TRLRKLVNKAFTSRAIEKLRPEIEQITGELLAALPDEDPVDLLDAFAFPL
PIRVICLLLGVPLNFKSWSKALVSGDSPAATAAASTAMIEYLGDLIERKR
RTPTDDVLAALVSARDVDDRLTETELVSMAFLLFIGGHETTVNTLGNGTL
HLMRNLDQWEALRQDRSLLPGAVEEFLRLESPLKHATFRCATEDLRIGDT
AIPAGDFVLLALASANRDPERFGDPHTLDVRRPTGGHVAFGHGIHYCLGA
PLARMEAQVAFGVLLDTFPAMRLAVDPEDMRWRTSTLIRGLHSLPVRLN

3D structure

• PDB: 6xa2 Molecular Basis of Iterative C─H Oxidation by TamI, a Multifunctional P450 monooxygenase from the Tirandamycin Biosynthetic Pathway.
• Chain: A
• Resolution: 2.64 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S186 E251 T252 C359 L360 G361
• Catalytic site (residue number reindexed from 1): S174 E239 T240 C347 L348 G349

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M100 L101 H108 R112 L244 G248 G249 T252 L295 A298 T299 R301 A351 F352 H357 C359 G361	M92 L93 H100 R104 L232 G236 G237 T240 L283 A286 T287 R289 A339 F340 H345 C347 G349
BS02	V0A	A	F92 L101 V185 G248 L295 T299 S397 T398 L399 I400	F84 L93 V173 G236 L283 T287 S385 T386 L387 I388

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:6xa2, PDBe:6xa2, PDBj:6xa2
• PDBsum: 6xa2
• PubMed: 33569241
• UniProt: D3Y1J3