Structure of PDB 6x8j Chain A |
>6x8jA (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ |
|
PDB | 6x8j Caspase-7 in complex with ketomethylene inhibitor reveals tetrahedral adduct |
Chain | A |
Resolution | 2.604 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R87 H144 C186 |
R31 H88 C130 |
|
|
|
|