Structure of PDB 6x7x Chain A

Receptor sequence

>6x7xA (length=187) Species: 178399 (Marinomonas primoryensis) [Search protein sequence]

QDDSTPDSLFAGLVGEYYGTNSQLNNISDFRALVDSKEADATFEAANISY
GRGSSDVAKGTHLQEFLGSDASTLSTDPGDNTDGGIYLQGYVYLEAGTYN
FKVTADDGYEITINGNPVATVDNNQSVYTVTHASFTISESGYQAIDMIWW
DQGGDYVFQPTLSADGGSTYFVLDSAILSSTGETPYT

3D structure

PDB

6x7x Structural Basis of Ligand Selectivity by a Bacterial Adhesin Lectin Involved in Multispecies Biofilm Formation.

Chain

Resolution

1.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D110 D111 D155 G157 D159	D106 D107 D151 G153 D155
BS02	CA	A	Q27 D87 Q156	Q23 D83 Q152
BS03	CA	A	S73 S76	S69 S72
BS04	CA	A	G64 D81 P82	G60 D77 P78
BS05	CA	A	Q5 D7 T9 D11	Q1 D3 T5 D7
BS06	CA	A	Y22 V38 K41	Y18 V34 K37
BS07	MAN	A	D110 D111 Q129 S130 Q156 G157 D159	D106 D107 Q125 S126 Q152 G153 D155
BS08	BMA	A	D110 D111 Q129 Q156 G157 D159	D106 D107 Q125 Q152 G153 D155

External links

PDB	RCSB:6x7x, PDBe:6x7x, PDBj:6x7x
PDBsum	6x7x
PubMed	33824212
UniProt	A1YIY3

[Back to BioLiP]