Structure of PDB 6x7j Chain A

Receptor sequence
>6x7jA (length=182) Species: 178399 (Marinomonas primoryensis) [Search protein sequence]
PDSLFAGLVGEYYGTNSQLNNISDFRALVDSKEADATFEAANISYGRGSS
DVAKGTHLQEFLGSDASTLSTDPGDNTDGGIYLQGYVYLEAGTYNFKVTA
DDGYEITINGNPVATVDNNQSVYTVTHASFTISESGYQAIDMIWWDQGGD
YVFQPTLSADGGSTYFVLDSAILSSTGETPYT
3D structure
PDB6x7j Structural Basis of Ligand Selectivity by a Bacterial Adhesin Lectin Involved in Multispecies Biofilm Formation.
ChainA
Resolution0.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FUL A D110 D111 Q129 Q156 G157 D159 D101 D102 Q120 Q147 G148 D150
BS02 CA A D110 D111 D155 G157 D159 D101 D102 D146 G148 D150
BS03 CA A G64 D81 P82 G55 D72 P73
BS04 CA A Q27 D87 Q156 Q18 D78 Q147
BS05 CA A Y22 V38 K41 Y13 V29 K32
BS06 FUC A D110 D111 Q129 Q156 G157 D159 D101 D102 Q120 Q147 G148 D150
BS07 CA A S73 S76 S64 S67
External links