Structure of PDB 6x76 Chain A

Receptor sequence

>6x76A (length=438) Species: 4932 (Saccharomyces cerevisiae)

IVACDDPDFLTSYFAHSRGHHLSAWKANLKDKFLNENIHKYTKITDKDTY
IIFHIDFDCFFATVAYLCRSSSFSACDFKRDPIVVCHGTKNSDIASCNYV
ARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLN
IFNLILPISIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTV
SIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSSFKLDDLPGVGHS
TLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEE
SLKILYDPKEVLQRKSLSIDINWGIRFKNITQVDLFIERGCQYLLEKLNE
INKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEFGI
IATEMKSLYRTLGCPPMELRGLALQFNKLVDVGPDNNQ

3D structure

• PDB: 6x76 Visualizing Rev1 catalyze protein-template DNA synthesis.
• Chain: A
• Resolution: 2.53 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K332 E468 P551 G552 G554 S556 T557 Q663 F691 S692 R693 S694 R696	K26 E162 P245 G246 G248 S250 T251 Q357 F385 S386 R387 S388 R390
BS02	dna	A	Y319 H322 S323 R324 G325 H326 S329 H393 G394 T395 K396 N397 S398 K590 R620 K621 S622 L623 S624 I625 D626 N628 W629 K681 Y682 G684 M685	Y13 H16 S17 R18 G19 H20 S23 H87 G88 T89 K90 N91 S92 K284 R314 K315 S316 L317 S318 I319 D320 N322 W323 K375 Y376 G378 M379
BS03	MN	A	D362 D467 E468	D56 D161 E162
BS04	MN	A	D362 F363 D467	D56 F57 D161
BS05	MN	A	D548 V553	D242 V247
BS06	DCP	A	R324 D362 D364 C365 F366 F367 A401 S402 Y405 R408 N414 D467 K525	R18 D56 D58 C59 F60 F61 A95 S96 Y99 R102 N108 D161 K219

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:6x76, PDBe:6x76, PDBj:6x76
• PDBsum: 6x76
• PubMed: 32999062
• UniProt: P12689|REV1_YEAST DNA repair protein REV1 (Gene Name=REV1)