Structure of PDB 6x6d Chain A

Receptor sequence
>6x6dA (length=74) Species: 9606 (Homo sapiens) [Search protein sequence]
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIID
KIRRKNCPACRYRKCLQAGMNLEA
3D structure
PDB6x6d Structural basis for glucocorticoid receptor recognition of both unmodified and methylated binding sites, precursors of a modern recognition element.
ChainA
Resolution2.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A C431 H432 Y433 K442 K446 C15 H16 Y17 K26 K30
BS02 dna A G439 S440 F444 R447 R470 K471 R477 G23 S24 F28 R31 R54 K55 R61
BS03 ZN A C421 C424 C438 C441 C5 C8 C22 C25
BS04 ZN A C457 C463 C473 C476 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6x6d, PDBe:6x6d, PDBj:6x6d
PDBsum6x6d
PubMed34289059
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]