Structure of PDB 6x5a Chain A

Receptor sequence
>6x5aA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6x5a The molecular basis of tight nuclear tethering and inactivation of cGAS.
ChainA
Resolution4.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R42 R72 R83 F84 Q85 R116 V117 R6 R36 R47 F48 Q49 R80 V81
BS02 dna A H39 R40 Y41 P43 G44 R49 R63 K64 L65 R69 H3 R4 Y5 P7 G8 R13 R27 K28 L29 R33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6x5a, PDBe:6x5a, PDBj:6x5a
PDBsum6x5a
PubMed32911481
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]