Structure of PDB 6x15 Chain A

Receptor sequence

>6x15A (length=419) Species: 53953 (Pyrococcus horikoshii) [Search protein sequence]

MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLF
VRLLCMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLG
IIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQ
VLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNG
VMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLVYFVL
LKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVATFFIANALGSHLTVGQQLTIVLTAVLASI
GTAGVPGAGAIMLCMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMV
NVTGDLTGTAIVAKTEGTL

3D structure

PDB

6x15 Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.

Chain

Resolution

3.05 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	NA	A	G306 N310 N401 V402 D405	G306 N310 N401 V402 D405
BS02	NA	A	T308 M311 S349 I350 T352	T308 M311 S349 I350 T352
BS03	NA	A	Y89 T92 S93 N310 D312	Y89 T92 S93 N310 D312
BS04	ASP	A	S277 S278 T314 G354 A358 G359 D394 R397 T398	S277 S278 T314 G354 A358 G359 D394 R397 T398
BS05	6OU	A	Y4 Y7 F46 K196 G200 I207	Y4 Y7 F46 K196 G200 I207
BS06	6OU	A	P75 I159 Y167	P75 I159 Y167
BS07	6OU	A	L130 I133 T334 V335 G336 T340 L343	L130 I133 T334 V335 G336 T340 L343
BS08	6OU	A	L91 F95 L250	L91 F95 L250
BS09	6OU	A	I262 M269 M399	I262 M269 M399
BS10	6OU	A	F46 F210	F46 F210

Gene Ontology

	Molecular Function
GO:0005283	amino acid:sodium symporter activity
GO:0015108	chloride transmembrane transporter activity
GO:0015183	L-aspartate transmembrane transporter activity
GO:0015293	symporter activity
GO:0015501	glutamate:sodium symporter activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006865	amino acid transport
GO:0035725	sodium ion transmembrane transport
GO:0046942	carboxylic acid transport
GO:0070207	protein homotrimerization
GO:0070778	L-aspartate transmembrane transport
GO:0140009	L-aspartate import across plasma membrane
GO:1902476	chloride transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6x15, PDBe:6x15, PDBj:6x15
PDBsum	6x15
PubMed	33155546
UniProt	O59010\|GLT_PYRHO Glutamate transporter homolog (Gene Name=PH1295)

[Back to BioLiP]