Structure of PDB 6wti Chain A

Receptor sequence

>6wtiA (length=660) Species: 562 (Escherichia coli) [Search protein sequence]

MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLT
SVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYD
QIFTAHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTV
VGVILVNVSLGVGEFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIG
TTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVLIIASFPILTVTV
ALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSE
IAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGI
TTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVL
LAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNE
TWGKRAFWFWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAAS
GAVLIALGILCLVIQMYVSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFY
NFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPKNSGAGIVIAAFST
IFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQH
FDEITKAGLK

3D structure

PDB

6wti A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.

Chain

Resolution

2.38 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H106 D135 W170 G200 T201 H284 E286 Y288 S299 H333 H334 T359 K362 R481
Catalytic site (residue number reindexed from 1)	H106 D135 W170 G200 T201 H284 E286 Y288 S299 H333 H334 T359 K362 R481
Enzyme Commision number	7.1.1.3: ubiquinol oxidase (H(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	A	A76 M79 R80 F103 H106 G107 M110 I111 W170 I417 F420 H421 I424 F468 R481 R482	A76 M79 R80 F103 H106 G107 M110 I111 W170 I417 F420 H421 I424 F468 R481 R482
BS02	HEO	A	W280 V287 I291 H333 H334 T359 G395 G398 L401 A402 D407 H411 L416 H419 F420 V423 I424 R481	W280 V287 I291 H333 H334 T359 G395 G398 L401 A402 D407 H411 L416 H419 F420 V423 I424 R481
BS03	CU	A	H284 H333 H334	H284 H333 H334
BS04	UQ8	A	V17 T20 I21 L70 R71 A74 D75 M78 H98 Q101 I102 N157 L160	V17 T20 I21 L70 R71 A74 D75 M78 H98 Q101 I102 N157 L160
BS05	U9V	A	W48 M60 I62 M436 W440 F444 R523	W48 M60 I62 M436 W440 F444 R523

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005507	copper ion binding
GO:0005515	protein binding
GO:0009055	electron transfer activity
GO:0009486	cytochrome bo3 ubiquinol oxidase activity
GO:0015078	proton transmembrane transporter activity
GO:0015453	oxidoreduction-driven active transmembrane transporter activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0048039	ubiquinone binding

	Biological Process
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0019646	aerobic electron transport chain
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0009319	cytochrome o ubiquinol oxidase complex
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6wti, PDBe:6wti, PDBj:6wti
PDBsum	6wti
PubMed	33408407
UniProt	P0ABI8\|CYOB_ECOLI Cytochrome bo(3) ubiquinol oxidase subunit 1 (Gene Name=cyoB)

[Back to BioLiP]