Structure of PDB 6wth Chain A

Receptor sequence

>6wthA (length=381) Species: 9606 (Homo sapiens) [Search protein sequence]

VSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYK
YSSTLPHPLQRLKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINIL
SRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFND
KNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPA
FMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSK
YTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKL
QVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQN
NYTVNNKRNGVAKVNIFFKELNYKTNSESPS

3D structure

PDB

6wth Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.

Chain

Resolution

3.06 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NA	A	L135 N136 D338 V346 T347	L22 N23 D178 V186 T187

Gene Ontology

	Molecular Function
GO:0005272	sodium channel activity
GO:0005515	protein binding
GO:0015280	ligand-gated sodium channel activity
GO:0050699	WW domain binding

	Biological Process
GO:0006814	sodium ion transport
GO:0006883	intracellular sodium ion homeostasis
GO:0008217	regulation of blood pressure
GO:0034220	monoatomic ion transmembrane transport
GO:0035725	sodium ion transmembrane transport
GO:0050891	multicellular organismal-level water homeostasis
GO:0050909	sensory perception of taste
GO:0050914	sensory perception of salty taste
GO:0050915	sensory perception of sour taste
GO:0055078	sodium ion homeostasis
GO:0071468	cellular response to acidic pH
GO:0098662	inorganic cation transmembrane transport
GO:0098719	sodium ion import across plasma membrane
GO:1904045	cellular response to aldosterone
GO:1904117	cellular response to vasopressin

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0009897	external side of plasma membrane
GO:0016020	membrane
GO:0016324	apical plasma membrane
GO:0031410	cytoplasmic vesicle
GO:0031514	motile cilium
GO:0034706	sodium channel complex
GO:0060170	ciliary membrane
GO:0070062	extracellular exosome
GO:0097228	sperm principal piece

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6wth, PDBe:6wth, PDBj:6wth
PDBsum	6wth
PubMed	32729833
UniProt	P37088\|SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha (Gene Name=SCNN1A)

[Back to BioLiP]