Structure of PDB 6wre Chain A

Receptor sequence

>6wreA (length=358) Species: 10090 (Mus musculus)

PSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPIN
GPGPDFDLRDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQLEGGPGWLAG
ATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLA
RPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGN
HPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLK
WWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSV
CMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPS
WYVETMTQ

3D structure

• PDB: 6wre A novel 5'-hydroxyl dinucleotide hydrolase activity for the DXO/Rai1 family of enzymes.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.-
  3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	R95 E101 R102 W131 R132 G133 H134 L184 M185 G188 Y189 E234 K255 T256 K273 R294	R69 E75 R76 W105 R106 G107 H108 L158 M159 G162 Y163 E208 K229 T230 K247 R268
BS02	CA	A	D236 E253 L254	D210 E227 L228
BS03	U3P	A	R30 T31 Q32 G358 G359 P360	R4 T5 Q6 G332 G333 P334

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0004527 exonuclease activity
• GO:0008409 5'-3' exonuclease activity
• GO:0034353 mRNA 5'-diphosphatase activity
• GO:0046872 metal ion binding
• GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity

Biological Process

• GO:0006402 mRNA catabolic process
• GO:0050779 RNA destabilization
• GO:0071028 nuclear mRNA surveillance
• GO:0090304 nucleic acid metabolic process
• GO:0110155 NAD-cap decapping

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:6wre, PDBe:6wre, PDBj:6wre
• PDBsum: 6wre
• PubMed: 31777937
• UniProt: O70348|DXO_MOUSE Decapping and exoribonuclease protein (Gene Name=Dxo)