Structure of PDB 6wk8 Chain A |
>6wk8A (length=104) Species: 1321778 (Clostridiales bacterium oral taxon 876 str. F0540) [Search protein sequence] |
MAWLILIIAGIFEVVWAIALKYSNGFTRLIPSMITLIGMLISFYLLSQAT KTLPIGTAYAIWTGIGALGAVICGIIFFKEPLTALRIVFMILLLTGIIGL KATS |
|
PDB | 6wk8 The structural basis of promiscuity in small multidrug resistance transporters. |
Chain | A |
Resolution | 2.53 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PL0 |
A |
E13 M39 |
E13 M39 |
|
|
|
|