Structure of PDB 6wie Chain A

Receptor sequence

>6wieA (length=329) Species: 9606 (Homo sapiens)

PAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAAS
VLKALPSPVTTLSQLQGLPHFGEHSSRVVQELLEHGVCEEVERVRRSERY
QTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQ
DLSTPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFL
ITHPKEGQEAGLLPRVMCRLQDQGLILYHQHFERSFCIFRLPQPGSWKAV
RVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPE
QKTFFQAASEEDIFRHLGLEYLPPEQRNA

3D structure

• PDB: 6wie Structural snapshots of human DNA polymerase mu engaged on a DNA double-strand break.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D330 D332 D418
• Catalytic site (residue number reindexed from 1): D196 D198 D253
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L177 R442 R445 R449 K450 L456 N457	L43 R277 R280 R284 K285 L291 N292
BS02	dna	A	Q364 F385 E386 R387 H459	Q230 F232 E233 R234 H294
BS03	dna	A	G245 V246 G247 K249 T250 H329 D330 D332 F389 R416 D418 G433 W434 G436 K438	G111 V112 G113 K115 T116 H195 D196 D198 F236 R251 D253 G268 W269 G271 K273
BS04	dna	A	G174 R175 T178 F179 H204 G206 H208 S209	G40 R41 T44 F45 H70 G72 H74 S75
BS05	MG	A	D330 D332 D418	D196 D198 D253
BS06	MG	A	D330 D332	D196 D198

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:6wie, PDBe:6wie, PDBj:6wie
• PDBsum: 6wie
• PubMed: 32963245
• UniProt: Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu (Gene Name=POLM)