Structure of PDB 6wfi Chain A

Receptor sequence

>6wfiA (length=144) Species: 100226 (Streptomyces coelicolor A3(2))

SLTRIDHIGIACHDLDATVEFYRATYGFEVFHTEVNEEQGVREAMLKIND
TSDGGASYLQLLEPTREDSAVGKWLAKNGEGVHHIAFGTADVDADAADIR
DKGVRVLYDEPRRGSMGSRITFLHPKDCHGVLTELVTSAAVESP

3D structure

• PDB: 6wfi Substrate Enolate Intermediate and Mimic Captured in the Active Site of Streptomyces coelicolor Methylmalonyl-CoA Epimerase.
• Chain: A
• Resolution: 1.37 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H7 E43 Q60 H84 E134
• Catalytic site (residue number reindexed from 1): H7 E43 Q60 H84 E134

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	A	H7 Q60 H84 E134	H7 Q60 H84 E134
BS02	KFV	A	H7 Q39 Q60 A70 K73 W74 H83 H84 L107 G114 S115 I120 F122 P125 L132 E134	H7 Q39 Q60 A70 K73 W74 H83 H84 L107 G114 S115 I120 F122 P125 L132 E134

Gene Ontology

Molecular Function

• GO:0004493 methylmalonyl-CoA epimerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0046491 L-methylmalonyl-CoA metabolic process

External links

• PDB: RCSB:6wfi, PDBe:6wfi, PDBj:6wfi
• PDBsum: 6wfi
• PubMed: 34856049
• UniProt: Q9L2C2