Structure of PDB 6wf7 Chain A

Receptor sequence

>6wf7A (length=144) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence]

SLTRIDHIGIACHDLDATVEFYRATYGFEVFHTEVNEEQGVREAMLKIND
TSDGGASYLQLLEPTREDSAVGKWLAKNGEGVHHIAFGTADVDADAADIR
DKGVRVLYDEPRRGSMGSRITFLHPKDCHGVLTELVTSAAVESP

3D structure

PDB

6wf7 Substrate Enolate Intermediate and Mimic Captured in the Active Site of Streptomyces coelicolor Methylmalonyl-CoA Epimerase.

Chain

Resolution

1.55 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	H7 E43 Q60 H84 E134
Catalytic site (residue number reindexed from 1)	H7 E43 Q60 H84 E134
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MC0	A	Q39 E43 Q60 A70 W74 H83 H84 L107 G114 S115 F122 P125 K126 L132 E134	Q39 E43 Q60 A70 W74 H83 H84 L107 G114 S115 F122 P125 K126 L132 E134
BS02	MCA	A	Q39 Q60 A70 W74 H83 H84 L107 G114 S115 I120 F122 P125 K126 L132 E134	Q39 Q60 A70 W74 H83 H84 L107 G114 S115 I120 F122 P125 K126 L132 E134

Gene Ontology

	Molecular Function
GO:0004493	methylmalonyl-CoA epimerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0046491	L-methylmalonyl-CoA metabolic process

External links