Structure of PDB 6wf6 Chain A

Receptor sequence

>6wf6A (length=141) Species: 100226 (Streptomyces coelicolor A3(2))

SLTRIDHIGIACHDLDATVEFYRATYGFEVFHTEVNEEQGVREAMLKIND
TSDGGASYLQLLEPTREDSAVGKWLAKNGEGVHHIAFGTADVDADAADIR
DKGVRVLYDEPRRGSMGSRITFLHPKDCHGVLTELVTSAAV

3D structure

• PDB: 6wf6 Substrate Enolate Intermediate and Mimic Captured in the Active Site of Streptomyces coelicolor Methylmalonyl-CoA Epimerase.
• Chain: A
• Resolution: 1.39 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H7 E43 Q60 H84 E134
• Catalytic site (residue number reindexed from 1): H7 E43 Q60 H84 E134

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	A	H7 Q60 H84 E134	H7 Q60 H84 E134

Gene Ontology

Molecular Function

• GO:0004493 methylmalonyl-CoA epimerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0046491 L-methylmalonyl-CoA metabolic process

External links

• PDB: RCSB:6wf6, PDBe:6wf6, PDBj:6wf6
• PDBsum: 6wf6
• PubMed: 34856049
• UniProt: Q9L2C2