Structure of PDB 6wf2 Chain A

Receptor sequence

>6wf2A (length=321) Species: 10090 (Mus musculus) [Search protein sequence]

DIRPEMKEDIHDPTYQDEEGPPPKLEYVWRNIILMVLLHLGGLYGIILVP
SCKLYTCLFGIFYYMTSALGITAGAHRLWSHRTYKARLPLRIFLIIANTM
AFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVK
EKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVN
SLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVG
EGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATV
LARIKRTGDGSHKSSENLYFQ

3D structure

PDB

6wf2 Structure and Mechanism of a Unique Diiron Center in Mammalian Stearoyl-CoA Desaturase.

Chain

Resolution

3.51 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.19.1: stearoyl-CoA 9-desaturase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE	A	H116 H121 H153 H157 H297	H76 H81 H113 H117 H257
BS02	FE	A	H156 H265 H294 H298	H116 H225 H254 H258
BS03	3VV	A	N71 F142 Q143 N144 W149 R151 D152 H153 W180 L181 R184 K185 K190 G193 G194 Y250 T257 V260 N261 A288	N31 F102 Q103 N104 W109 R111 D112 H113 W140 L141 R144 K145 K150 G153 G154 Y210 T217 V220 N221 A248

Gene Ontology

	Molecular Function
GO:0004768	stearoyl-CoA 9-desaturase activity
GO:0005506	iron ion binding
GO:0016215	acyl-CoA desaturase activity
GO:0016491	oxidoreductase activity
GO:0016717	oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0032896	palmitoyl-CoA 9-desaturase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006629	lipid metabolic process
GO:0006633	fatty acid biosynthetic process
GO:0006636	unsaturated fatty acid biosynthetic process
GO:0006641	triglyceride metabolic process
GO:0007584	response to nutrient
GO:0008610	lipid biosynthetic process
GO:0009617	response to bacterium
GO:0042632	cholesterol homeostasis
GO:0048733	sebaceous gland development
GO:0050830	defense response to Gram-positive bacterium
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0055088	lipid homeostasis
GO:0055092	sterol homeostasis
GO:0070542	response to fatty acid
GO:0120162	positive regulation of cold-induced thermogenesis
GO:1903699	tarsal gland development
GO:1903966	monounsaturated fatty acid biosynthetic process

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6wf2, PDBe:6wf2, PDBj:6wf2
PDBsum	6wf2
PubMed	32470559
UniProt	P13516\|ACOD1_MOUSE Acyl-CoA desaturase 1 (Gene Name=Scd1)

[Back to BioLiP]