Structure of PDB 6wb4 Chain A

Receptor sequence

>6wb4A (length=298) Species: 77133 (uncultured bacterium)

TQADVLVVGGVGVDHIVRVKSLPLPVVDSMMVPPIVTVVGHTGNGVALGV
HALGRASAMADVIGDDAEGRLIQDAYSAAGIPITFVTHISGTRRSVNLVT
EEGQRMSLYDPRHPFEFIPDPSLWREGIERSRHVHVSIMNWARYALRDAV
AAGRSTSTDLHDWDGVADYHKDFAYGADYVFVSAAALRDESGVVADVFAR
GRAQFVVVMAGSEGARVWRRSDELPLRISPISIPGRPVVDSNGAGDSFVA
AFLCHYLDHGDIFGAARAGAVGGAWACGTLGTHTSFVDVETLERLLAR

3D structure

• PDB: 6wb4 The human microbiome encodes resistance to the antidiabetic drug acarbose.
• Chain: A
• Resolution: 2.593 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AC1	A	T43 Y110 H162 D163	T42 Y109 H161 D162
BS02	ATP	A	H162 S184 M210 G212 G215 V239 A245 F249 C278	H161 S183 M209 G211 G214 V238 A244 F248 C277
BS03	CA	A	T43 G44	T42 G43
BS04	CA	A	D160 H162	D159 H161

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 23:25:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6wb4', asym_id = 'A', title = 'The human microbiome encodes resistance to the antidiabetic drug acarbose.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6wb4', asym_id='A', title='The human microbiome encodes resistance to the antidiabetic drug acarbose.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016301', uniprot = '', pdbid = '6wb4', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016301', uniprot='', pdbid='6wb4', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>