Structure of PDB 6vtx Chain A

Receptor sequence
>6vtxA (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
HTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTR
HYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRH
3D structure
PDB6vtx Liquid condensation of reprogramming factor KLF4 with DNA provides a mechanism for chromatin organization.
ChainA
Resolution2.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A H446 W469 R473 E476 R479 H480 F499 R501 H504 H508 H17 W40 R44 E47 R50 H51 F70 R72 H75 H79
BS02 dna A S445 Y460 S474 T478 F490 S16 Y31 S45 T49 F61
BS03 ZN A C462 C467 H480 H484 C33 C38 H51 H55
BS04 ZN A C492 C495 H508 H512 C63 C66 H79 H83
BS05 ZN A C432 C437 H450 H454 C3 C8 H21 H25
External links
PDB RCSB:6vtx, PDBe:6vtx, PDBj:6vtx
PDBsum6vtx
PubMed34552088
UniProtO43474|KLF4_HUMAN Krueppel-like factor 4 (Gene Name=KLF4)

[Back to BioLiP]