Structure of PDB 6vqw Chain A |
>6vqwA (length=80) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
TMSTAYIIFNSSVAAVVDTEIANGANVTFSTVTVKEEINANRDFNLVNAQ NGKISRAKRWGNEASKCEYFGREINPTEFF |
|
PDB | 6vqw Inhibition mechanisms of AcrF9, AcrF8, and AcrF6 against type I-F CRISPR-Cas complex revealed by cryo-EM. |
Chain | A |
Resolution | 3.42 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
I31 N33 |
I21 N23 |
|
|
|