Structure of PDB 6vpq Chain A

Receptor sequence
>6vpqA (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
KTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASV
TGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGE
3D structure
PDB6vpq Crystal structure of the C-terminal domain of DENR.
ChainA
Resolution1.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A T171 D172 T63 D64
BS02 MG A D176 Q179 D68 Q71
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003729 mRNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0002188 translation reinitiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0032790 ribosome disassembly
GO:0075522 IRES-dependent viral translational initiation
Cellular Component
GO:0005575 cellular_component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vpq, PDBe:6vpq, PDBj:6vpq
PDBsum6vpq
PubMed32257053
UniProtO43583|DENR_HUMAN Density-regulated protein (Gene Name=DENR)

[Back to BioLiP]