Structure of PDB 6vly Chain A

Receptor sequence

>6vlyA (length=293) Species: 214856 (Alistipes finegoldii)

SGLVPRGSHMAYNLLKGKKGLIFGALNEQSIAWKVAERAVEEGAEIVLTN
TAVSIRMGTIGRLAEKCNTIVVPADATSVEDLENLIDKTMEHFGGKFDFM
LHSIGMSPNVRKGRTYDDLDYDYLSKTLDISAISFHKAIQVARKKDAIND
WGSIVALSYIAAQRTLYGYNDMADAKALLESIARSFGYIYGREKHVRINT
VSQSPTPTTAGSGVLGMGDLMNFAENMSPLGNASANDCADYVLTLFSDLT
RKVTMQNLYHDGGFASMGMSRRAMKTYEKGMRFEDVHQNQYPF

3D structure

• PDB: 6vly The genome of a Bacteroidetes inhabitant of the human gut encodes a structurally distinct enoyl-acyl carrier protein reductase (FabI).
• Chain: A
• Resolution: 1.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	A	G15 S21 N41 T42 S45 D66 A67 S94 I95 L148 S149 K167 Q194 P196 T197 T199 A201	G24 S30 N50 T51 S54 D75 A76 S103 I104 L157 S158 K176 Q203 P205 T206 T208 A210	MOAD: Kd=225nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 04:24:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6vly', asym_id = 'A', title = 'The genome of a Bacteroidetes inhabitant of the ...nct enoyl-acyl carrier protein reductase (FabI). '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6vly', asym_id='A', title='The genome of a Bacteroidetes inhabitant of the ...nct enoyl-acyl carrier protein reductase (FabI). ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '6vly', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='6vly', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>