Structure of PDB 6vgg Chain A

Receptor sequence
>6vggA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
MPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGER
KSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
3D structure
PDB6vgg Allosteric interference in oncogenic FLI1 and ERG transactions by mithramycins.
ChainA
Resolution4.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R367 R370 Y373 K380 K384 Y386 R63 R66 Y69 K76 K80 Y82
BS02 dna A Q312 L313 W351 K355 K357 M360 K364 R367 A368 Y371 Q8 L9 W47 K51 K53 M56 K60 R63 A64 Y67
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6vgg, PDBe:6vgg, PDBj:6vgg
PDBsum6vgg
PubMed33275876
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]