Structure of PDB 6vg8 Chain A

Receptor sequence
>6vg8A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
MPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGER
KSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQ
3D structure
PDB6vg8 Allosteric interference in oncogenic FLI1 and ERG transactions by mithramycins.
ChainA
Resolution4.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R337 R340 Y341 Y343 K350 Y356 R63 R66 Y67 Y69 K76 Y82
BS02 dna A Q282 L283 W321 K325 K327 M330 K334 R337 Y342 Q8 L9 W47 K51 K53 M56 K60 R63 Y68
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6vg8, PDBe:6vg8, PDBj:6vg8
PDBsum6vg8
PubMed33275876
UniProtQ01543|FLI1_HUMAN Friend leukemia integration 1 transcription factor (Gene Name=FLI1)

[Back to BioLiP]