Structure of PDB 6v1c Chain A

Receptor sequence

>6v1cA (length=53) Species: 9606 (Homo sapiens)

VGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQ
EAE

3D structure

• PDB: 6v1c Trefoil factors share a lectin activity that defines their role in mucus.
• Chain: A
• Resolution: 1.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	A	P24 H25 P43 G44 W47	P21 H22 P40 G41 W44

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0010906 regulation of glucose metabolic process
• GO:0030277 maintenance of gastrointestinal epithelium

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0030141 secretory granule

External links

• PDB: RCSB:6v1c, PDBe:6v1c, PDBj:6v1c
• PDBsum: 6v1c
• PubMed: 32404934
• UniProt: Q07654|TFF3_HUMAN Trefoil factor 3 (Gene Name=TFF3)